PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G142400.1
Common NameB456_006G142400, LOC105799546
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 686aa    MW: 75494.5 Da    PI: 9.4472
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G142400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.54.7e-111044136
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt 36
                        ++ W t+E++ll++av+++G+++W+++a +++ +Rt
  Gorai.006G142400.1 10 KQTWGTWEELLLACAVHRHGSNSWDSVAMELQ-KRT 44
                        789*****************************.999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.6E-7967IPR001005SANT/Myb domain
SuperFamilySSF466894.04E-5967IPR009057Homeodomain-like
PfamPF002494.6E-101045IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-41060IPR009057Homeodomain-like
CDDcd001672.14E-61265No hitNo description
Gene3DG3DSA:1.20.920.101.9E-13284419IPR001487Bromodomain
SMARTSM002972.7E-14299408IPR001487Bromodomain
SuperFamilySSF473701.23E-15301407IPR001487Bromodomain
CDDcd043694.50E-13310403No hitNo description
PfamPF004391.2E-9314392IPR001487Bromodomain
PROSITE profilePS5001413.686318389IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MAKPHNFPEK QTWGTWEELL LACAVHRHGS NSWDSVAMEL QKRTSTFQHL FFTPLSCQQK  60
FQDLKRRFAE NGDDDETTNN ISTSAVPWLD ELRKLRVAEL RREVQQYDLS IVSLQLKVQK  120
LKEEREQSLT ENGKETEKSD LEREKGSEKK EENETENITR RPVNSREESE RENRSVNESN  180
STDPKEEDPG TGPDEAKDEP EPVEPDGGET GKEVQSVKPE GEASCNGSCD SVAKGSAENS  240
KRVDPRETGD SPESVAESKG EEPNRESSDV QSSASLSGKE KKNAEPGEPD NGELDQSPSI  300
KKVSVESQPL VEFLEIFQSH KLGSLFERRL ESQKTPDYSN LIRQHLDLET IGLRVEEGWY  360
SGCKSKFFRD LLLLLTNAII FFGKESSEYA AAIEFRQLVS KEIDAQFRNS SVLPKEQSPN  420
RVLESEMPLK PEPQLSLSLS MKPKLSVPLI ACRKRSSIAA KSSTSSSGQE KKRQLLASLM  480
NEKPALGWKQ HDKSIEESPV AKKRTRESSA SGSRKASKNA KARSNTNTNK NSGTNANAAI  540
SSKGGSSNDN SESKGGEKEK SNSKTASSKK PSAANFLNRM RSSLSGNEPL TETLKGVISS  600
DKGKGGGDAG EHKKNSTSSK GDQQKDRTPT PRTRSGGKRT SPAKRSTGRP PKRVPATQSA  660
PPGKRGREAV ENHSGGGQAK KRSRK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5802545e-90JX580254.1 Gossypium hirsutum clone NBRI_GE12650 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485630.10.0PREDICTED: muscle M-line assembly protein unc-89-like
TrEMBLA0A0D2RW910.0A0A0D2RW91_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65302539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57980.15e-99DNA-binding bromodomain-containing protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]